PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00033.1.g01800.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 534aa    MW: 57522.4 Da    PI: 10.3447
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00033.1.g01800.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.5e-39217276261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   ++k l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  Zjn_sc00033.1.g01800.1.am.mk 217 PDKVLPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 276
                                   78999****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-31206274IPR003851Zinc finger, Dof-type
PfamPF027019.2E-32218275IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.984221275IPR003851Zinc finger, Dof-type
PROSITE patternPS013610223259IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MGSHEATARW RRRRSGQGRT GKRRRPGRRR KSGIDRRIKN RTVEATSRAC GSRSSPWPPP  60
APRTPLIPPP PLLLSSFHGR AEHQPAEILP ASSLTCIDHL PRFVSFSFSS NPLLNRETRE  120
RRAGGGGGDG LIKLFGTTIP VPEAGDAKDL QLSGGSSSGS IESDATKENN TRQQQDTSDP  180
SPQPEVVDAE DPKSSPRQQP GGDRDEANDR KEKLRKPDKV LPCPRCNSMD TKFCYFNNYN  240
VNQPRHFCKN CQRYWTAGGA MRNVPVGAGR RKNKNALAAS YSFLQRVRAA AMPAGGDPLN  300
TNGTVLSFGG GNHQSGGPCS EGSSNRDDRN MGGTKDHVAV SNPANGVQHP ANMNGAPMWP  360
PYSCAPIPSH RPAYYPPPGI AIPIQPVAPG YWGCMLPGGW NLPWAPVPSP TSQGLSSPTS  420
APSVSSGADS LTVLGKHARP EGDEGRSHGS GMVWAPKTIR IDDADEVAKS SIWSLIGIKG  480
DKKNADMDGR KQHGTVFEPK HDAKTAKQEM ITSSPHLHAN PVALTRLLTF QEGS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11130RRRSGQGRTGKRRRPGRRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9567842e-82EU956784.1 Zea mays clone 1573856 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983151.11e-170PREDICTED: cyclic dof factor 1-like
TrEMBLK4AA811e-170K4AA81_SETIT; Uncharacterized protein
STRINGSi035787m1e-170(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-56cycling DOF factor 2